Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Apple & Potato Cake

Crispy-bottomed German apple-potato bake, golden and custardy inside. A one-pan weeknight dinner that tastes like autumn comfort food.

Total time
25 min
Servings
4
Calories
285
Protein
9g
Sheet-Pan Apple & Potato Cake
comfortwholesomegermanvegetarianeggscrispytenderfluffy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Peel and thinly slice the potatoes and apples, keeping them separate.

  2. Step 2

    Whisk eggs, milk, flour, salt, pepper, and caraway seeds in a bowl until smooth.

  3. Step 3

    Oil a 9x13-inch baking sheet or cast-iron skillet. Layer half the sliced potatoes on the bottom.

  4. Step 4

    Layer all the apple slices over potatoes, then the remaining potatoes on top.

  5. Step 5

    Pour the egg mixture evenly over the stack. Drizzle the top with a thin layer of oil.

  6. Step 6

    Bake 18–20 minutes until the top is golden brown and a knife inserted in the center meets no resistance.

Tools you’ll need

  • 9x13-inch baking sheet or 12-inch cast-iron skillet
  • mixing bowl
  • whisk
  • vegetable peeler or mandoline
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.