CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Sheet-Pan Beef Doner with Garlic Sauce

Ground beef seasoned with warm spices and smoked paprika, roasted until crispy, then piled into warm pita with garlicky yogurt and fresh toppings. Ready in 18 minutes.

Total time
18 min
Servings
2
Calories
620
Protein
42g
Sheet-Pan Beef Doner with Garlic Sauce
casualsatisfyingmiddle-easternbeefcrispytenderweeknightsandwich

Ingredients

  • 1 lb ground beef
  • 2 tsp smoked paprika
  • 1 tsp ground cumin
  • ½ cup Greek yogurt
  • 4 pieces pita bread
  • 1 medium tomato, diced
  • ½ small red onion, thinly sliced

Instructions

  1. 1

    Heat oven to 425°F. Spread ground beef on a sheet pan, breaking it into small crumbles with a spoon.

  2. 2

    Toss beef with paprika, cumin, salt, and pepper. Spread in a thin, even layer across the pan.

  3. 3

    Roast for 12 minutes, stirring halfway, until beef is browned and edges are crispy.

  4. 4

    While beef roasts, stir yogurt with minced garlic, lemon juice, and a pinch of salt.

  5. 5

    Warm pita directly over a gas flame or wrap in foil in the oven for the last 2 minutes.

  6. 6

    Divide crispy beef among warm pitas. Top with tomato, red onion, and a dollop of garlic yogurt. Serve hot.

Tools you’ll need

  • sheet pan
  • wooden spoon
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.