Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Beef Lahmacun with Garlic Sauce

Turkish-style meat flatbread with a paper-thin, golden-crispy crust topped with spiced ground beef and fresh garnishes. Build-your-own wraps with garlicky yogurt sauce, lemon, and chili heat.

Total time
18 min
Servings
2
Calories
385
Protein
22g
Crispy Beef Lahmacun with Garlic Sauce
casualsatisfyingmiddle-easternbeefcrispytenderweeknightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a skillet over medium-high. Brown ground beef, breaking it up with a spoon, until no pink remains, ~4 minutes. Season with salt, pepper, and a pinch of chili flakes.

  2. Step 2

    Toast naan directly over a gas flame or under a broiler until puffed and charred in spots, ~2 minutes per side. Work quickly so it stays supple.

  3. Step 3

    Lay naan flat. Spread garlic yogurt sauce over the surface, leaving a 0.5-inch border.

  4. Step 4

    Top with cooked beef, diced tomatoes, sliced red onion, and fresh spinach. Squeeze lemon over everything.

  5. Step 5

    Fold or roll loosely and serve immediately. The warmth of the meat will gently wilt the spinach.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon
  • gas stove or oven broiler

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.