Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Herb Fougasse

A 25-minute baked flatbread inspired by Provençal fougasse—stretchy, dimpled, and brushed with herbed olive oil. No yeast rising required; uses store-bought dough for weeknight ease.

Total time
25 min
Servings
4
Calories
285
Protein
7g
Crispy Herb Fougasse
rusticcasualfrenchvegancrispyairyweeknightbread

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 450°F. Line a large sheet pan with parchment paper.

  2. Step 2

    Stretch dough on the pan into a thin 12×8-inch rectangle. Use your fingers to dimple the surface all over.

  3. Step 3

    Whisk together 3 tbsp olive oil, herbs, minced garlic, red pepper flakes, and lemon zest in a small bowl.

  4. Step 4

    Brush herb oil evenly over the dough. Sprinkle with coarse salt. Slash 3–4 diagonal cuts into the bread without cutting all the way through.

  5. Step 5

    Bake until edges are deep golden and center springs back when poked, 12–15 minutes. Surface should look crispy and puffed.

  6. Step 6

    Drizzle with remaining 1 tbsp olive oil. Cool 2 minutes, then tear into pieces and serve warm.

Tools you’ll need

  • sheet pan (18×13-inch)
  • parchment paper
  • small bowl
  • whisk
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.