Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet Pan Gochujang Beef & Scallions

Thin-sliced beef tossed in a sticky gochujang glaze with charred scallions and toasted sesame seeds. Salty, spicy, and ready in 20 minutes—the kind of dinner that photographs like a restaurant dish.

Total time
20 min
Servings
2
Calories
380
Protein
38g
Sheet Pan Gochujang Beef & Scallions
quickcasualkoreanbeeftendercrispyweeknightmain-dish

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix gochujang, soy sauce, honey, sesame oil, and minced garlic in a small bowl until smooth.

  2. Step 2

    Heat olive oil in a large sheet pan or skillet over medium-high until shimmering, about 90 seconds.

  3. Step 3

    Add beef slices in a single layer and sear without stirring for 2 minutes until edges brown.

  4. Step 4

    Stir the beef, add scallions, then pour the gochujang sauce over everything and toss for 1 minute.

  5. Step 5

    Scatter sesame seeds over the top and remove from heat.

  6. Step 6

    Serve immediately over rice or with steamed vegetables.

Tools you’ll need

  • 12-inch skillet or sheet pan
  • small bowl
  • spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.