CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Sheet-Pan Iskender — Spiced Beef, Yogurt & Charred Veg

Seasoned ground beef on pita, topped with warm yogurt sauce and finished with charred tomatoes and peppers. A 20-minute Turkish-inspired dinner that tastes like a kebab shop in your kitchen.

Total time
20 min
Servings
2
Calories
620
Protein
38g
Sheet-Pan Iskender — Spiced Beef, Yogurt & Charred Veg
comfortcasualturkishbeefcrispytendercreamyweeknight

Ingredients

  • ¾ lb ground beef
  • 2 rounds pita bread
  • ¾ cup plain yogurt
  • 2 whole plum tomato
  • 1 whole red bell pepper
  • 3 tbsp butter
  • ½ tsp sumac (or red pepper flakes)

Instructions

  1. 1

    Heat 1 tbsp butter in a large skillet over medium-high. Brown ground beef, breaking it up with a spoon, until no pink remains, ~5 minutes.

  2. 2

    Season beef with 0.25 tsp salt, 0.125 tsp pepper, and sumac. Stir to combine, then remove to a plate.

  3. 3

    Add remaining 2 tbsp butter to the skillet. Halve tomatoes and pepper lengthwise; sear cut-side down until charred, ~3 minutes.

  4. 4

    Warm pita on the skillet for 1 minute per side until soft and pliable. Transfer to plates.

  5. 5

    Top pita with cooked beef, then drizzle with warm yogurt until the bread is half-submerged and sauce pools around the edges.

  6. 6

    Arrange charred tomato and pepper on top. Serve immediately while yogurt is still warm and pita is soft.

Tools you’ll need

  • large 12-inch skillet
  • wooden spoon
  • plates

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.