Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Iskender — Spiced Beef, Yogurt & Charred Veg

Seasoned ground beef on pita, topped with warm yogurt sauce and finished with charred tomatoes and peppers. A 20-minute Turkish-inspired dinner that tastes like a kebab shop in your kitchen.

Total time
20 min
Servings
2
Calories
620
Protein
38g
Sheet-Pan Iskender — Spiced Beef, Yogurt & Charred Veg
comfortcasualturkishbeefcrispytendercreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp butter in a large skillet over medium-high. Brown ground beef, breaking it up with a spoon, until no pink remains, ~5 minutes.

  2. Step 2

    Season beef with 0.25 tsp salt, 0.125 tsp pepper, and sumac. Stir to combine, then remove to a plate.

  3. Step 3

    Add remaining 2 tbsp butter to the skillet. Halve tomatoes and pepper lengthwise; sear cut-side down until charred, ~3 minutes.

  4. Step 4

    Warm pita on the skillet for 1 minute per side until soft and pliable. Transfer to plates.

  5. Step 5

    Top pita with cooked beef, then drizzle with warm yogurt until the bread is half-submerged and sauce pools around the edges.

  6. Step 6

    Arrange charred tomato and pepper on top. Serve immediately while yogurt is still warm and pita is soft.

Tools you’ll need

  • large 12-inch skillet
  • wooden spoon
  • plates

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.