Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet Pan Mini Meatloaves with Green Beans & Potatoes

Three mini meatloaves roast alongside crispy potatoes and tender green beans on one sheet pan. Everything cooks together in under 25 minutes for a complete weeknight dinner.

Total time
25 min
Servings
4
Calories
385
Protein
28g
Sheet Pan Mini Meatloaves with Green Beans & Potatoes
comfortsimpleamericanbeeftendercrispyweeknightmain-dish

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix ground beef with 0.5 tsp salt and 0.25 tsp pepper, then shape into three compact ovals.

  2. Step 2

    Toss potatoes with 1 tbsp oil, salt, and pepper; spread on a sheet pan in one layer.

  3. Step 3

    Roast potatoes at 425°F for 12 minutes until starting to soften.

  4. Step 4

    Push potatoes to edges, place meatloaves in center, toss green beans with oil and add to pan.

  5. Step 5

    Roast 10 more minutes until meatloaves reach 160°F internal temp and beans are tender-crisp.

  6. Step 6

    Rest 2 minutes, then divide among plates and serve hot.

Tools you’ll need

  • sheet pan (18×13 inch)
  • instant-read thermometer

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.