CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Sheet Pan Mini Meatloaves with Green Beans & Potatoes

Three mini meatloaves roast alongside crispy potatoes and tender green beans on one sheet pan. Everything cooks together in under 25 minutes for a complete weeknight dinner.

Total time
25 min
Servings
4
Calories
385
Protein
28g
Sheet Pan Mini Meatloaves with Green Beans & Potatoes
comfortsimpleamericanbeeftendercrispyweeknightmain-dish

Ingredients

  • 1 lb ground beef
  • 1 lb potatoes, cut into 1-inch cubes
  • ¾ lb fresh green beans, trimmed

Instructions

  1. 1

    Mix ground beef with 0.5 tsp salt and 0.25 tsp pepper, then shape into three compact ovals.

  2. 2

    Toss potatoes with 1 tbsp oil, salt, and pepper; spread on a sheet pan in one layer.

  3. 3

    Roast potatoes at 425°F for 12 minutes until starting to soften.

  4. 4

    Push potatoes to edges, place meatloaves in center, toss green beans with oil and add to pan.

  5. 5

    Roast 10 more minutes until meatloaves reach 160°F internal temp and beans are tender-crisp.

  6. 6

    Rest 2 minutes, then divide among plates and serve hot.

Tools you’ll need

  • sheet pan (18×13 inch)
  • instant-read thermometer

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.