Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet Pan Pork Chops with Potatoes & Broccoli

Pork chops, potatoes, and broccoli roast together on one sheet pan in under 25 minutes. Everything cooks at once — no babysitting required.

Total time
25 min
Servings
2
Calories
520
Protein
42g
Sheet Pan Pork Chops with Potatoes & Broccoli
comfortsimpleamericanporktendercrispyweeknightmain-dish

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 425°F and line a sheet pan with foil.

  2. Step 2

    Pat pork chops dry, season with salt and pepper, then place on the sheet pan.

  3. Step 3

    Toss potatoes and broccoli with 2 tbsp olive oil, salt, and pepper; spread around the chops.

  4. Step 4

    Roast until pork reaches 145°F internal temp and potatoes are golden, about 18–20 minutes.

  5. Step 5

    Remove from oven and let rest 3 minutes before serving hot.

Tools you’ll need

  • sheet pan
  • aluminum foil
  • meat thermometer
  • tongs or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.