Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Orata with Lemon & Herbs

Whole branzino (or sea bream) roasted on a sheet pan with cherry tomatoes, olives, and fresh herbs — golden, tender, ready in 18 minutes. Pure Italian simplicity.

Total time
18 min
Servings
2
Calories
320
Protein
38g
Sheet-Pan Orata with Lemon & Herbs
elegantsimpleitalianfishtenderflakyweeknightdate-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Pat the fish dry inside and out with paper towels.

  2. Step 2

    Arrange the tomatoes, olives, and lemon slices on a sheet pan. Drizzle with 1 tbsp oil and a pinch of salt.

  3. Step 3

    Rub the fish with remaining 2 tbsp oil. Season inside and out with salt, pepper, and half the herbs.

  4. Step 4

    Nestle the fish among the vegetables on the pan. Scatter remaining herbs over the top.

  5. Step 5

    Roast until the flesh is opaque and flakes easily at the thickest part, 12–14 minutes.

  6. Step 6

    Serve hot, drizzling pan juices over the fish and vegetables.

Tools you’ll need

  • sheet pan (13×18 inch)
  • paper towels
  • oven (preheated to 425°F)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.