Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Branzino with Lemon & Herbs

Whole branzino stuffed with fresh herbs and lemon, roasted on a sheet pan until the skin crisps and flesh flakes. Dinner in under 20 minutes with zero fuss.

Total time
18 min
Servings
2
Calories
320
Protein
42g
Sheet-Pan Branzino with Lemon & Herbs
elegantsimplemediterraneanfishcrispytenderflakyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Slice 1 lemon into thin rounds; cut the other in half and reserve.

  2. Step 2

    Pat both fish dry inside and out. Stuff each cavity with half the herbs, half the garlic, and half the lemon slices.

  3. Step 3

    Arrange fish on a sheet pan, drizzle with olive oil, season generously with salt and pepper.

  4. Step 4

    Roast 12–14 minutes until skin crisps and flesh flakes easily at the thickest point.

  5. Step 5

    Squeeze reserved lemon half over the fish. Serve immediately from the pan.

Tools you’ll need

  • sheet pan (13 × 18 inches)
  • oven
  • knife and cutting board
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.