Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Zucchini Parm

Crispy-edged zucchini slices layered with marinara and melty mozzarella, baked until golden. A 20-minute vegetarian dinner that tastes like you spent way longer on it.

Total time
20 min
Servings
4
Calories
285
Protein
14g
Sheet-Pan Zucchini Parm
comfortitalianvegetariancheesecrispymeltytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice zucchini lengthwise into 1/4-inch-thick planks. Pat dry with paper towels.

  2. Step 2

    Brush zucchini slices on both sides with olive oil. Arrange on a sheet pan in a single layer.

  3. Step 3

    Bake at 425°F for 8 minutes until zucchini is tender and edges start to brown.

  4. Step 4

    Stir garlic into marinara. Spread half the sauce over the zucchini, then layer with mozzarella and half the Parmesan.

  5. Step 5

    Top with remaining sauce, then remaining Parmesan. Bake 8 minutes until cheese melts and bubbles at the edges.

  6. Step 6

    Let cool 2 minutes, then serve hot.

Tools you’ll need

  • sheet pan
  • chef's knife
  • paper towels
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.