Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Shrimp Scampi with Linguine

Tender shrimp and garlic-forward butter sauce cling to delicate linguine in under 20 minutes. Bright lemon and white wine balance the richness for a restaurant-quality weeknight dinner.

Total time
18 min
Servings
2
Calories
628
Protein
38g
Shrimp Scampi with Linguine
elegantquickitalianshrimptendercreamyweeknightdate-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large pot. Add linguine and cook until al dente, ~9 minutes. Reserve 1 cup pasta water, then drain.

  2. Step 2

    Melt butter in a 12-inch skillet over medium-high heat. Add garlic and cook until fragrant, ~30 seconds.

  3. Step 3

    Add shrimp to the skillet in a single layer. Sear 90 seconds without moving until edges turn pink.

  4. Step 4

    Flip shrimp and sear another 90 seconds until opaque throughout. Transfer to a plate.

  5. Step 5

    Pour white wine into the skillet, scraping the bottom to release browned bits. Simmer 1 minute.

  6. Step 6

    Add cooked linguine and lemon juice to the skillet. Toss, adding pasta water 1/4 cup at a time until silky.

  7. Step 7

    Return shrimp to the skillet and toss gently. Season with salt and pepper to taste.

  8. Step 8

    Divide between bowls and serve immediately.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • tongs
  • wooden spoon
  • measuring cups
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.