CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Shrimp Scampi with Linguine

Tender shrimp and garlic-forward butter sauce cling to delicate linguine in under 20 minutes. Bright lemon and white wine balance the richness for a restaurant-quality weeknight dinner.

Total time
18 min
Servings
2
Calories
628
Protein
38g
Shrimp Scampi with Linguine
elegantquickitalianshrimptendercreamyweeknightdate-night

Ingredients

  • ½ lb linguine pasta
  • 1 lb large shrimp, peeled and deveined
  • 4 tbsp butter
  • 4 clove garlic, minced
  • ½ cup dry white wine
  • 1 whole lemon (juiced)

Instructions

  1. 1

    Boil salted water in a large pot. Add linguine and cook until al dente, ~9 minutes. Reserve 1 cup pasta water, then drain.

  2. 2

    Melt butter in a 12-inch skillet over medium-high heat. Add garlic and cook until fragrant, ~30 seconds.

  3. 3

    Add shrimp to the skillet in a single layer. Sear 90 seconds without moving until edges turn pink.

  4. 4

    Flip shrimp and sear another 90 seconds until opaque throughout. Transfer to a plate.

  5. 5

    Pour white wine into the skillet, scraping the bottom to release browned bits. Simmer 1 minute.

  6. 6

    Add cooked linguine and lemon juice to the skillet. Toss, adding pasta water 1/4 cup at a time until silky.

  7. 7

    Return shrimp to the skillet and toss gently. Season with salt and pepper to taste.

  8. 8

    Divide between bowls and serve immediately.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • tongs
  • wooden spoon
  • measuring cups
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.