Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Filipino Shrimp & Sweet Potato Ukoy

Crispy pan-fried fritters packed with shrimp, sweet potato, and green onion. Served with a tangy vinegar dipping sauce, these are ready in 25 minutes.

Total time
25 min
Servings
4
Calories
285
Protein
12g
Filipino Shrimp & Sweet Potato Ukoy
casualcomfortfilipinoshrimpcrispytenderweeknightdinner

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Roughly chop shrimp into 0.5-inch pieces. Squeeze excess moisture from grated sweet potato using paper towels.

  2. Step 2

    Whisk together flour, water, salt, and pepper until a thick batter forms. Fold in shrimp, sweet potato, and green onion.

  3. Step 3

    Stir vinegar and minced garlic together in a small bowl. Set aside.

  4. Step 4

    Heat oil in a 12-inch skillet over medium-high until a drop of batter sizzles immediately, ~2 minutes.

  5. Step 5

    Drop heaping tablespoons of batter into the oil without crowding. Fry until deep golden brown, ~2 minutes per side.

  6. Step 6

    Transfer ukoy to a paper-towel-lined plate to drain. Work in batches if needed.

  7. Step 7

    Serve hot ukoy with vinegar-garlic sauce on the side for dipping.

Tools you’ll need

  • box grater
  • paper towels
  • large mixing bowl
  • whisk
  • 12-inch skillet
  • slotted spoon
  • small bowl
  • kitchen thermometer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.