Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Shrimp Tempura

Crispy, delicate Japanese fried shrimp with a light, airy batter. Serve hot with dipping sauce for an elegant appetizer or light meal.

Total time
20 min
Servings
2
Calories
320
Protein
16g
Shrimp Tempura
elegantlightjapaneseshrimpcrispyairytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the shrimp dry with paper towels by pressing each shrimp between two folded towels until no moisture beads on the surface. This helps the batter stick.

  2. Step 2

    Pour the flour, cornstarch, and salt into a large mixing bowl. Whisk them together until evenly combined and no white streaks of flour remain.

  3. Step 3

    Pour the cold water into the flour mixture and whisk until the batter looks like thin pancake batter — no lumps visible and the consistency pours easily.

  4. Step 4

    Fill a heavy pot or deep skillet with 3 inches of oil and heat over medium-high heat until the oil shimmers and a wooden chopstick inserted in it releases tiny bubbles immediately, about 5 minutes.

  5. Step 5

    Grip one shrimp by its tail, dip it into the batter until fully coated, then carefully lay it away from you into the hot oil. Repeat with 4 more shrimp, working in small batches so the pan is not crowded.

  6. Step 6

    Fry the shrimp undisturbed for 90 seconds until the bottom turns the color of light honey and no longer sticks to the bottom of the pot.

  7. Step 7

    Flip each shrimp with chopsticks or a fork and fry for another 60 to 90 seconds until the entire coating is the color of warm honey and looks crispy and blistered.

  8. Step 8

    Use a slotted spoon to lift each shrimp from the oil and place it on a plate lined with paper towels. Repeat steps 5–7 with the remaining 7 shrimp in two more batches.

  9. Step 9

    Serve the shrimp hot on a clean plate, drizzled lightly with salt if desired.

Tools you’ll need

  • large mixing bowl
  • whisk
  • heavy-bottomed pot or deep skillet, at least 4 quarts
  • instant-read or candy thermometer (optional but helpful)
  • wooden chopsticks or fork
  • slotted spoon
  • paper towels
  • medium plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.