Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Minute Shrimp Tempura Soba

Crispy shrimp and shiso leaf tempura over buckwheat noodles in a light dashi-based broth. Served with wasabi, scallions, and a dipping sauce that doubles as the finishing broth.

Total time
25 min
Servings
2
Calories
480
Protein
18g
25-Minute Shrimp Tempura Soba
lightelegantjapaneseshrimpcrispytenderweeknightdinner

Ingredients

10 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat shrimp and shiso leaves dry with paper towels.

  2. Step 2

    Heat oil in a heavy-bottomed pot to 350°F (175°C). Test with a drop of batter — it should sizzle immediately and float.

  3. Step 3

    Whisk flour and ice-cold club soda just until combined (batter should be lumpy, not smooth).

  4. Step 4

    Dip shrimp into batter, then fry 2–3 minutes until golden and opaque inside. Work in batches to avoid crowding.

  5. Step 5

    Dip shiso leaves in batter, fry until crispy, 1–2 minutes. Transfer all tempura to a paper-towel-lined plate.

  6. Step 6

    Boil soba in salted water for 4 minutes, drain, and divide between two bowls.

  7. Step 7

    Warm broth with soy sauce, pour over noodles. Top with shrimp tempura, shiso leaf, and scallions.

  8. Step 8

    Serve with wasabi on the side and extra soy sauce as a dipping sauce.

Tools you’ll need

  • heavy-bottomed pot (3–4 quart capacity)
  • candy or deep-fry thermometer
  • small mixing bowl
  • whisk
  • slotted spoon or spider strainer
  • paper towels
  • two serving bowls
  • chopsticks or tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.