CookSnap is in beta — Get it free on TestFlight →
Back to recipes

25-Minute Shrimp Tempura Soba

Crispy shrimp and shiso leaf tempura over buckwheat noodles in a light dashi-based broth. Served with wasabi, scallions, and a dipping sauce that doubles as the finishing broth.

Total time
25 min
Servings
2
Calories
480
Protein
18g
25-Minute Shrimp Tempura Soba
lightelegantjapaneseshrimpcrispytenderweeknightdinner

Ingredients

  • 10 pieces large shrimp, peeled and deveined
  • 4 leaves fresh shiso leaves
  • 6 oz soba noodles (buckwheat)
  • 2 cups dashi or light seafood broth
  • 3 cups neutral cooking oil for frying
  • ½ cup all-purpose flour
  • ½ cup ice-cold club soda or water
  • 2 tbsp scallions, thinly sliced
  • 1 tsp wasabi paste
  • 1 tbsp soy sauce

Instructions

  1. 1

    Pat shrimp and shiso leaves dry with paper towels.

  2. 2

    Heat oil in a heavy-bottomed pot to 350°F (175°C). Test with a drop of batter — it should sizzle immediately and float.

  3. 3

    Whisk flour and ice-cold club soda just until combined (batter should be lumpy, not smooth).

  4. 4

    Dip shrimp into batter, then fry 2–3 minutes until golden and opaque inside. Work in batches to avoid crowding.

  5. 5

    Dip shiso leaves in batter, fry until crispy, 1–2 minutes. Transfer all tempura to a paper-towel-lined plate.

  6. 6

    Boil soba in salted water for 4 minutes, drain, and divide between two bowls.

  7. 7

    Warm broth with soy sauce, pour over noodles. Top with shrimp tempura, shiso leaf, and scallions.

  8. 8

    Serve with wasabi on the side and extra soy sauce as a dipping sauce.

Tools you’ll need

  • heavy-bottomed pot (3–4 quart capacity)
  • candy or deep-fry thermometer
  • small mixing bowl
  • whisk
  • slotted spoon or spider strainer
  • paper towels
  • two serving bowls
  • chopsticks or tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.