Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Shrimp Youvetsi with Orzo

Sheet-pan shrimp and orzo baked in garlicky tomato sauce with feta. The kind of one-pan Greek dinner that tastes like you spent hours but takes less than 20 minutes.

Total time
18 min
Servings
2
Calories
468
Protein
42g
20-Min Shrimp Youvetsi with Orzo
comfortquickgreekshrimptendercreamyweeknightpasta

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Add orzo, crushed tomatoes, garlic, lemon zest, 1.5 cups water, and a pinch of salt to a 9x13-inch baking dish.

  2. Step 2

    Bake orzo for 8 minutes until it starts to soften, stirring once halfway through.

  3. Step 3

    Pat shrimp dry with paper towels. Toss with salt, pepper, and olive oil.

  4. Step 4

    Remove baking dish from oven. Stir the orzo, then nestle shrimp into the sauce in a single layer.

  5. Step 5

    Bake for 6–7 minutes until shrimp turn opaque and the liquid is mostly absorbed.

  6. Step 6

    Remove from oven, scatter feta over the top, and squeeze lemon juice over everything. Serve hot.

Tools you’ll need

  • 9x13-inch baking dish
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.