CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Hilopites with Tomato & Feta

Toasted Greek pasta squares tossed with warm tomato sauce, melting feta, and a hit of garlic and oregano. A 20-minute weeknight dinner that tastes like you've been cooking all day.

Total time
20 min
Servings
2
Calories
520
Protein
18g
Crispy Hilopites with Tomato & Feta
comfortsimplegreekvegetariancheesecrispytendercreamy

Ingredients

  • 8 oz hilopites (Greek square pasta)
  • 14 oz canned crushed tomatoes
  • ¾ cup feta cheese, crumbled
  • 3 clove garlic cloves, minced
  • 1 tsp dried oregano
  • ¼ tsp red pepper flakes
  • 2 tbsp fresh parsley or dill, chopped (optional)

Instructions

  1. 1

    Boil hilopites in salted water until al dente, about 9 minutes. Drain and set aside.

  2. 2

    Heat olive oil in a large skillet over medium. Add garlic and cook 45 seconds until fragrant.

  3. 3

    Pour in crushed tomatoes, oregano, and red pepper flakes. Simmer 5 minutes, stirring occasionally.

  4. 4

    Add cooked hilopites to the sauce and toss until coated, about 1 minute.

  5. 5

    Remove from heat. Fold in feta cheese until it begins to soften and melt into the warm pasta.

  6. 6

    Divide between bowls. Sprinkle with fresh parsley or dill if desired. Serve immediately.

Tools you’ll need

  • large pot
  • large skillet (12-inch)
  • colander
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.