Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Hilopites with Tomato & Feta

Toasted Greek pasta squares tossed with warm tomato sauce, melting feta, and a hit of garlic and oregano. A 20-minute weeknight dinner that tastes like you've been cooking all day.

Total time
20 min
Servings
2
Calories
520
Protein
18g
Crispy Hilopites with Tomato & Feta
comfortsimplegreekvegetariancheesecrispytendercreamy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil hilopites in salted water until al dente, about 9 minutes. Drain and set aside.

  2. Step 2

    Heat olive oil in a large skillet over medium. Add garlic and cook 45 seconds until fragrant.

  3. Step 3

    Pour in crushed tomatoes, oregano, and red pepper flakes. Simmer 5 minutes, stirring occasionally.

  4. Step 4

    Add cooked hilopites to the sauce and toss until coated, about 1 minute.

  5. Step 5

    Remove from heat. Fold in feta cheese until it begins to soften and melt into the warm pasta.

  6. Step 6

    Divide between bowls. Sprinkle with fresh parsley or dill if desired. Serve immediately.

Tools you’ll need

  • large pot
  • large skillet (12-inch)
  • colander
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.