Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Smoked Beef Cheeks — 20-Minute Pan

Pre-smoked beef cheeks seared until caramelized and tender, finished with a quick pan glaze. Showstopping restaurant-quality plate in under 20 minutes.

Total time
18 min
Servings
2
Calories
445
Protein
52g
Smoked Beef Cheeks — 20-Minute Pan
elegantsatisfyingamericanbeeftendercrispyweeknightdate-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat beef cheeks dry with paper towels. Season generously with salt and black pepper on both sides.

  2. Step 2

    Heat 1 tbsp butter in a 12-inch skillet over medium-high until it foams, about 1 minute.

  3. Step 3

    Sear beef cheeks 2 minutes per side without moving — surface should be deep brown and crispy.

  4. Step 4

    Remove cheeks to a plate. Add garlic and thyme to the pan, cook 30 seconds until fragrant.

  5. Step 5

    Pour in stock and balsamic, scraping browned bits. Return cheeks to pan, simmer 3 minutes.

  6. Step 6

    Swirl in remaining 1 tbsp butter until glaze looks glossy. Plate cheeks and drizzle pan sauce over top.

Tools you’ll need

  • 12-inch stainless steel or cast iron skillet
  • paper towels
  • tongs
  • plate
  • spoon or wooden spoon for scraping

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.