Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Smoked Salmon Toast with Dill Crème

Scandinavian open-faced sandwich with crispy rye toast, briny smoked salmon, and tangy dill crème fraîche. No cooking required — just assembly and 10 minutes start to finish.

Total time
10 min
Servings
2
Calories
285
Protein
18g
Smoked Salmon Toast with Dill Crème
lightfreshscandinaviangluten-freefishcrispycreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toast the rye bread until the surface is crispy and edges curl slightly, 2–3 minutes.

  2. Step 2

    Stir crème fraîche with dill, lemon juice, and a pinch of salt until smooth.

  3. Step 3

    Spread dill crème on each toast, then layer smoked salmon and thin red onion slices.

  4. Step 4

    Finish with lemon zest and a crack of black pepper. Serve immediately.

Tools you’ll need

  • toaster or toaster oven
  • small bowl
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.