Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Southern Fried Okra

Crispy, golden okra fried until the outside crackles and the inside stays tender. A classic Southern side that's irresistible hot from the pan.

Total time
20 min
Servings
4
Calories
285
Protein
3g
Southern Fried Okra
comfortcasualsouthernvegetariancrispytenderweeknightbbq

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rinse the okra under cold water and pat it completely dry with paper towels — moisture is the enemy of crispiness.

  2. Step 2

    Trim the stem end of each okra pod by cutting off the very top, about 1/4 inch, with a paring knife in one straight cut.

  3. Step 3

    Pour the cornmeal and flour into a medium bowl and stir them together with a fork until well combined and uniform.

  4. Step 4

    Add 1 teaspoon salt and 0.5 teaspoon black pepper to the cornmeal mixture and stir with the fork until the seasoning is evenly distributed.

  5. Step 5

    Pour 2 cups vegetable oil into a large skillet and heat over medium-high heat until the oil shimmers and a single okra pod sizzles immediately when dropped in, about 3–4 minutes.

  6. Step 6

    Add about one-third of the okra to the cornmeal mixture and shake the bowl gently to coat each piece on all sides with an even layer of cornmeal.

  7. Step 7

    Carefully slide the coated okra from the bowl into the hot oil, using a slotted spoon or fork so excess cornmeal stays in the bowl.

  8. Step 8

    Fry, stirring gently with a slotted spoon once every 30 seconds, until the okra is golden brown all over and the coating looks crispy, about 3–4 minutes total.

  9. Step 9

    Use the slotted spoon to scoop the fried okra out of the oil and onto a plate lined with paper towels to drain.

  10. Step 10

    Repeat steps 6–9 with the remaining two batches of okra, allowing the oil temperature to recover between batches, about 1 minute each time.

  11. Step 11

    Once all the okra is fried and drained, taste a piece and add extra salt and pepper to the pile if you prefer — serve hot.

Tools you’ll need

  • large skillet (12-inch)
  • medium mixing bowl
  • fork
  • paring knife
  • cutting board
  • paper towels
  • slotted spoon
  • instant-read thermometer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.