Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spam Fried Rice with Egg

Crispy pan-fried rice with salty Spam, scrambled eggs, and aromatics cooked in one skillet. Ready in under 30 minutes with pantry staples.

Total time
25 min
Servings
4
Calories
485
Protein
16g
Spam Fried Rice with Egg
comfortquickasianspameggscrispytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice Spam into 1/4-inch-thick rounds, then cut each round into small cubes.

  2. Step 2

    Whisk eggs in a bowl with a pinch of salt and black pepper.

  3. Step 3

    Heat 1 tbsp olive oil in a 12-inch skillet over medium-high until shimmering.

  4. Step 4

    Add Spam cubes and cook, stirring occasionally, until edges brown, ~4 minutes.

  5. Step 5

    Push Spam to the side, pour eggs into empty space, and scramble until set, ~2 minutes.

  6. Step 6

    Add onion and cook, stirring, until softened, ~2 minutes.

  7. Step 7

    Stir in garlic and cook until fragrant, ~30 seconds.

  8. Step 8

    Add chilled rice, breaking up clumps, and stir-fry for 2 minutes.

  9. Step 9

    Stir in peas and soy sauce, tossing to coat evenly, ~1 minute.

  10. Step 10

    Drizzle sesame oil over the top and toss. Serve immediately.

Tools you’ll need

  • 12-inch skillet or wok
  • wooden spoon
  • small bowl for eggs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.