Custrd is out on the App Store — Download it free →
Back to recipes

Spiced Shrimp in Yogurt Sauce

Juicy shrimp simmered in a creamy, lightly spiced yogurt sauce with a sprinkle of sesame seeds and fresh herbs. Ready in about 20 minutes, this quick dish is perfect for a weeknight dinner or a satisfying snack.

Total time
20 min
Servings
4
Calories
220
Protein
25g
Spiced Shrimp in Yogurt Sauce
comfortingMediterraneangluten-freeshrimpcreamytenderweeknightmain

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a bowl, mix 1 cup yogurt, 2 minced garlic cloves, 1 tsp ground cumin, and 0.5 tsp salt. Set aside.

  2. Step 2

    Heat 2 tbsp olive oil in a skillet over medium-high heat. Add 1 lb shrimp and cook until pink and opaque, about 2-3 minutes per side.

  3. Step 3

    Reduce heat to low and pour the yogurt mixture over the shrimp. Stir gently and cook until warmed through, about 2 minutes, without boiling.

  4. Step 4

    Serve immediately, garnished with sesame seeds and fresh herbs if desired.

Tools you’ll need

  • skillet
  • mixing bowl
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.