Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spicy Cajun Alfredo with Crispy Chicken

Seared cajun-spiced chicken over creamy parmesan pasta with garlic butter and a kick of hot sauce. Ready in under 25 minutes on one skillet.

Total time
25 min
Servings
2
Calories
782
Protein
48g
Spicy Cajun Alfredo with Crispy Chicken
comfortindulgentcajunchickencrispycreamytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large skillet over high heat. Add fettuccine and cook until al dente, about 8 minutes. Drain, reserving 0.5 cup pasta water.

  2. Step 2

    Pat chicken breasts dry. Coat both sides generously with cajun seasoning, salt, and black pepper.

  3. Step 3

    Melt 1 tbsp butter in the same skillet over medium-high heat. Sear chicken 4-5 minutes per side until golden and cooked through (internal temp 165°F). Transfer to a cutting board.

  4. Step 4

    Add remaining 2 tbsp butter and minced garlic to the skillet. Cook 30 seconds until fragrant, then add cream and bring to a simmer.

  5. Step 5

    Stir in parmesan until melted and smooth, about 60 seconds. Add hot sauce and 0.25 cup reserved pasta water. Stir to combine.

  6. Step 6

    Return pasta to the skillet and toss to coat. Slice chicken and arrange on top. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • cutting board
  • instant-read thermometer
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.