CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Spicy Cajun Alfredo with Crispy Chicken

Seared cajun-spiced chicken over creamy parmesan pasta with garlic butter and a kick of hot sauce. Ready in under 25 minutes on one skillet.

Total time
25 min
Servings
2
Calories
782
Protein
48g
Spicy Cajun Alfredo with Crispy Chicken
comfortindulgentcajunchickencrispycreamytenderweeknight

Ingredients

  • ¾ lb boneless, skinless chicken breasts
  • 8 oz fettuccine pasta
  • ¾ cup heavy cream
  • ¾ cup parmesan cheese, grated
  • 1.5 tbsp cajun seasoning
  • 1 tbsp hot sauce (Frank's RedHot or similar)
  • 3 cloves garlic cloves, minced
  • 3 tbsp butter

Instructions

  1. 1

    Boil salted water in a large skillet over high heat. Add fettuccine and cook until al dente, about 8 minutes. Drain, reserving 0.5 cup pasta water.

  2. 2

    Pat chicken breasts dry. Coat both sides generously with cajun seasoning, salt, and black pepper.

  3. 3

    Melt 1 tbsp butter in the same skillet over medium-high heat. Sear chicken 4-5 minutes per side until golden and cooked through (internal temp 165°F). Transfer to a cutting board.

  4. 4

    Add remaining 2 tbsp butter and minced garlic to the skillet. Cook 30 seconds until fragrant, then add cream and bring to a simmer.

  5. 5

    Stir in parmesan until melted and smooth, about 60 seconds. Add hot sauce and 0.25 cup reserved pasta water. Stir to combine.

  6. 6

    Return pasta to the skillet and toss to coat. Slice chicken and arrange on top. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • cutting board
  • instant-read thermometer
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.