CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Spicy Cajun Chicken Alfredo

Creamy Alfredo pasta with blackened chicken, bold Cajun spice, and crispy garlic bread—dinner in under 30 minutes. A TikTok-easy weeknight that actually slaps.

Total time
28 min
Servings
2
Calories
1185
Protein
52g
Spicy Cajun Chicken Alfredo
comfortindulgentcajunchickencreamytendercrispyweeknight

Ingredients

  • 8 oz fettuccine pasta
  • ¾ lb boneless, skinless chicken breasts
  • 1 cup heavy cream
  • 4 tbsp butter
  • ¾ cup parmesan cheese, grated
  • 2 tsp Cajun seasoning
  • 2 slices garlic bread (store-bought or homemade)

Instructions

  1. 1

    Boil pasta in salted water until al dente, then drain and set aside.

  2. 2

    Pat chicken dry, season both sides with Cajun seasoning and salt.

  3. 3

    Heat 2 tbsp butter in a large skillet over medium-high until it foams. Sear chicken 5-6 minutes per side until golden and cooked through, then slice.

  4. 4

    In the same skillet, melt remaining 2 tbsp butter over medium. Add cream and bring to a gentle simmer, ~2 minutes.

  5. 5

    Stir in parmesan until melted and smooth, then add pasta and toss to coat.

  6. 6

    Divide pasta between plates, top with sliced chicken, and serve with warm garlic bread alongside.

Tools you’ll need

  • large skillet (12-inch)
  • pot
  • tongs
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.