Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spicy Cajun Chicken Alfredo

Creamy Alfredo pasta with blackened chicken, bold Cajun spice, and crispy garlic bread—dinner in under 30 minutes. A TikTok-easy weeknight that actually slaps.

Total time
28 min
Servings
2
Calories
1185
Protein
52g
Spicy Cajun Chicken Alfredo
comfortindulgentcajunchickencreamytendercrispyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil pasta in salted water until al dente, then drain and set aside.

  2. Step 2

    Pat chicken dry, season both sides with Cajun seasoning and salt.

  3. Step 3

    Heat 2 tbsp butter in a large skillet over medium-high until it foams. Sear chicken 5-6 minutes per side until golden and cooked through, then slice.

  4. Step 4

    In the same skillet, melt remaining 2 tbsp butter over medium. Add cream and bring to a gentle simmer, ~2 minutes.

  5. Step 5

    Stir in parmesan until melted and smooth, then add pasta and toss to coat.

  6. Step 6

    Divide pasta between plates, top with sliced chicken, and serve with warm garlic bread alongside.

Tools you’ll need

  • large skillet (12-inch)
  • pot
  • tongs
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.