Custrd is out on the App Store — Download it free →
Back to recipes

Spicy Indonesian Chicken with Herbs

A quick and fiery chicken stir-fry with fresh herbs and chilies, inspired by Indonesian flavors. Ready in about 20 minutes, perfect for a weeknight dinner.

Total time
20 min
Servings
4
Calories
380
Protein
35g
Spicy Indonesian Chicken with Herbs
comfortingIndonesiangluten-freedairy-freechickentenderweeknightmain

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over medium-high. Add 4 sliced shallots and 4 minced garlic cloves; cook until fragrant and golden, about 3 minutes.

  2. Step 2

    Add 1.5 lb chicken pieces; cook until browned on all sides, about 5 minutes. Stir in 4 sliced red and 4 sliced green chilies; cook 2 minutes more.

  3. Step 3

    Add 6 sliced kaffir lime leaves and 1/2 cup water; simmer until chicken is cooked through and sauce thickens slightly, about 5 minutes. Season with salt to taste.

  4. Step 4

    Serve hot with steamed rice, if desired.

Tools you’ll need

  • Large skillet
  • Cutting board
  • Knife
  • Measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.