Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spicy Michelada with Chili-Lime Rim

A tangy, spicy beer cocktail with a chili-salt rim, fresh lime juice, and Mexican hot sauce. Serve ice-cold with tortilla chips and salsa verde on the side.

Total time
5 min
Servings
2
Calories
148
Protein
1g
Spicy Michelada with Chili-Lime Rim
refreshingcelebratorymexicanvegetarianvegancrispyweeknightcasual

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rim two chilled glasses by running a lime wedge around the edge, then dip into chili powder mixed with a pinch of salt.

  2. Step 2

    Fill glasses with ice, then pour 12 oz beer into each glass.

  3. Step 3

    Add 1 tbsp lime juice, 0.5 tbsp hot sauce, and 0.25 tbsp Worcestershire to each glass.

  4. Step 4

    Stir gently with a bar spoon or long spoon until combined and chilled.

  5. Step 5

    Serve immediately with tortilla chips and salsa verde on the side.

Tools you’ll need

  • two chilled glasses or pint glasses
  • bar spoon or long spoon
  • small dish or plate for chili powder rim
  • ice

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.