CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Spicy Michelada with Chili-Lime Rim

A tangy, spicy beer cocktail with a chili-salt rim, fresh lime juice, and Mexican hot sauce. Serve ice-cold with tortilla chips and salsa verde on the side.

Total time
5 min
Servings
2
Calories
148
Protein
1g
Spicy Michelada with Chili-Lime Rim
refreshingcelebratorymexicanvegetarianvegancrispyweeknightcasual

Ingredients

  • 24 oz lager or Mexican beer (like Corona or Modelo)
  • 2 tbsp fresh lime juice
  • 1 tbsp hot sauce (like Valentina or Tabasco)
  • ½ tbsp Worcestershire sauce
  • 2 tbsp chili powder or Tajín seasoning
  • 1 whole lime wedge, for rim

Instructions

  1. 1

    Rim two chilled glasses by running a lime wedge around the edge, then dip into chili powder mixed with a pinch of salt.

  2. 2

    Fill glasses with ice, then pour 12 oz beer into each glass.

  3. 3

    Add 1 tbsp lime juice, 0.5 tbsp hot sauce, and 0.25 tbsp Worcestershire to each glass.

  4. 4

    Stir gently with a bar spoon or long spoon until combined and chilled.

  5. 5

    Serve immediately with tortilla chips and salsa verde on the side.

Tools you’ll need

  • two chilled glasses or pint glasses
  • bar spoon or long spoon
  • small dish or plate for chili powder rim
  • ice

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.