Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spicy Shrimp Mie Aceh

Tangled noodles tossed with tender shrimp in a fiery ginger-garlic broth with a crispy fried-shallot crown. One-pan, 20 minutes, TikTok-worthy.

Total time
20 min
Servings
2
Calories
420
Protein
28g
Spicy Shrimp Mie Aceh
boldcomfortindonesianshrimpchewycrispyweeknightnoodle-bowl

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large skillet over high heat. Add noodles and cook until just tender, about 3 minutes. Drain and set aside.

  2. Step 2

    Return skillet to medium-high heat. Add 1 tbsp oil, then sauté ginger and chili for 30 seconds until fragrant.

  3. Step 3

    Add shrimp and cook, stirring occasionally, until pink and cooked through, about 3 minutes.

  4. Step 4

    Pour in broth and return to a boil. Add noodles back to the skillet and toss to combine, 1 minute.

  5. Step 5

    Transfer to bowls. Top with fried shallots and sliced scallion. Serve immediately.

Tools you’ll need

  • large skillet (12-inch minimum)
  • slotted spoon or tongs
  • cutting board and knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.