Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Crispy Chili Garlic Pancit

Stir-fried Filipino noodles loaded with vegetables, tossed in a garlicky chili-soy glaze, and finished with crispy edges. One skillet, weeknight-easy, and totally addictive.

Total time
15 min
Servings
4
Calories
285
Protein
8g
15-Min Crispy Chili Garlic Pancit
comfortquickfilipinovegetarianvegetariancrispychewyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cook noodles in boiling salted water until al dente, about 3 minutes. Drain and set aside.

  2. Step 2

    Heat oil in a large skillet over medium-high until shimmering. Add garlic, stir for 30 seconds until fragrant.

  3. Step 3

    Add cabbage and carrot, toss constantly for 3 minutes until edges start to char and soften.

  4. Step 4

    Pour in soy sauce and chili crisp, toss to coat evenly. Cook for 1 minute until glaze coats the vegetables.

  5. Step 5

    Add cooked noodles to the skillet, toss constantly for 2 minutes until noodles crisp at the edges and everything is hot.

  6. Step 6

    Serve immediately in bowls or on a plate while the noodles still have crispy bits.

Tools you’ll need

  • large skillet (12-inch preferred)
  • pot for boiling water
  • tongs or wooden spoon
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.