Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Spinach & Cheese Gozleme

Turkish hand-stretched flatbread folded around a garlicky spinach-and-cheese filling, pan-fried until golden and crispy. A weeknight dinner that tastes like a Turkish street stall.

Total time
25 min
Servings
2
Calories
420
Protein
13g
Crispy Spinach & Cheese Gozleme
casualsatisfyingturkishvegetariancheesecrispytendermelty

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour, warm water, and a pinch of salt in a bowl until shaggy. Knead for 2 minutes until soft and slightly sticky.

  2. Step 2

    Heat 1 tbsp oil in a large skillet over medium. Add garlic and cook 30 seconds until fragrant.

  3. Step 3

    Add spinach in batches, stirring until wilted, ~2 minutes. Remove from heat and stir in feta, lemon juice, and red pepper flakes.

  4. Step 4

    Divide dough in half. On a flour-dusted surface, stretch one half into a thin 8-inch round, rotating as you go.

  5. Step 5

    Spread half the spinach-feta filling on one half of the round, fold dough over to seal, and press edges gently.

  6. Step 6

    Wipe skillet clean, heat 1 tbsp oil over medium-high until shimmering. Slide gozleme in and cook 2–3 minutes per side until golden and crispy. Repeat with remaining dough and filling.

Tools you’ll need

  • large mixing bowl
  • 12-inch non-stick or cast iron skillet
  • wooden spoon
  • rolling surface (counter or cutting board)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.