CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Spinach & Feta Borek

Crispy phyllo pastry wrapped around spiced spinach and creamy feta. A Turkish classic that looks showstopping but comes together quickly with store-bought pastry.

Total time
45 min
Servings
4
Calories
385
Protein
10g
Spinach & Feta Borek
elegantrusticturkishvegetariancheesecrispycreamyflaky

Ingredients

  • 10 oz fresh spinach, roughly chopped
  • 6 oz feta cheese, crumbled
  • ½ medium onion, finely diced
  • 8 sheets phyllo pastry sheets
  • ½ cup olive oil
  • 2 tbsp fresh dill, chopped
  • 2 cloves garlic, minced
  • ½ tsp salt
  • ¼ tsp black pepper

Instructions

  1. 1

    Heat 1 tbsp olive oil in a large skillet over medium. Add diced onion.

  2. 2

    Sauté onion until softened, ~4 minutes. Add minced garlic; cook 30 seconds until fragrant.

  3. 3

    Add spinach in batches, stirring until wilted and any liquid cooks off, ~5 minutes.

  4. 4

    Remove from heat. Stir in crumbled feta, fresh dill, salt, and pepper. Cool 5 minutes.

  5. 5

    Preheat oven to 375°F. Line a baking sheet with parchment paper.

  6. 6

    Lay one phyllo sheet on a work surface. Brush lightly with olive oil.

  7. 7

    Add 2 more phyllo sheets, brushing oil between each layer. Spread half the spinach filling along one long edge.

  8. 8

    Roll tightly into a cylinder, tucking sides in as you go. Place seam-side down on baking sheet.

  9. 9

    Repeat with remaining 4 phyllo sheets, oil, and remaining filling to make a second roll.

  10. 10

    Brush both rolls with remaining olive oil. Cut each into 4 equal pieces.

  11. 11

    Bake 20–25 minutes until golden brown and crispy. Serve warm.

Tools you’ll need

  • large skillet
  • baking sheet
  • parchment paper
  • pastry brush
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.