Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spinach & Feta Borek

Crispy phyllo pastry wrapped around spiced spinach and creamy feta. A Turkish classic that looks showstopping but comes together quickly with store-bought pastry.

Total time
45 min
Servings
4
Calories
385
Protein
10g
Spinach & Feta Borek
elegantrusticturkishvegetariancheesecrispycreamyflaky

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp olive oil in a large skillet over medium. Add diced onion.

  2. Step 2

    Sauté onion until softened, ~4 minutes. Add minced garlic; cook 30 seconds until fragrant.

  3. Step 3

    Add spinach in batches, stirring until wilted and any liquid cooks off, ~5 minutes.

  4. Step 4

    Remove from heat. Stir in crumbled feta, fresh dill, salt, and pepper. Cool 5 minutes.

  5. Step 5

    Preheat oven to 375°F. Line a baking sheet with parchment paper.

  6. Step 6

    Lay one phyllo sheet on a work surface. Brush lightly with olive oil.

  7. Step 7

    Add 2 more phyllo sheets, brushing oil between each layer. Spread half the spinach filling along one long edge.

  8. Step 8

    Roll tightly into a cylinder, tucking sides in as you go. Place seam-side down on baking sheet.

  9. Step 9

    Repeat with remaining 4 phyllo sheets, oil, and remaining filling to make a second roll.

  10. Step 10

    Brush both rolls with remaining olive oil. Cut each into 4 equal pieces.

  11. Step 11

    Bake 20–25 minutes until golden brown and crispy. Serve warm.

Tools you’ll need

  • large skillet
  • baking sheet
  • parchment paper
  • pastry brush
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.