Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Spinach & Feta Borek with Turkish Tea

Phyllo sheets stuffed with garlicky spinach and feta, baked until golden and shatteringly crisp. Served with Turkish tea, briny olives, and cool cucumbers for a complete Turkish spread.

Total time
18 min
Servings
2
Calories
385
Protein
12g
Crispy Spinach & Feta Borek with Turkish Tea
casualsatisfyingturkishvegetariancheesecrispyflakycreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp olive oil in a large skillet over medium. Add minced garlic and cook 30 seconds until fragrant.

  2. Step 2

    Add spinach and cook, stirring, until wilted and any liquid has evaporated, about 3 minutes.

  3. Step 3

    Remove from heat. Fold in crumbled feta and dill, then season with salt and pepper.

  4. Step 4

    Lay one phyllo sheet on a work surface, brush lightly with olive oil, then place 2 tbsp spinach-feta mixture in the center.

  5. Step 5

    Fold the phyllo into a triangle or envelope, sealing the edges. Repeat with remaining sheets and filling.

  6. Step 6

    Place boreks on a sheet pan, brush tops with remaining oil, and bake at 400°F until golden and crispy, 8–10 minutes.

  7. Step 7

    Serve hot with Turkish tea, green olives, and fresh cucumber slices on the side.

Tools you’ll need

  • large skillet
  • sheet pan
  • pastry brush
  • oven (preheated to 400°F)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.