Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Swedish Beef Wallenbergare with Roasted Veg

Tender ground beef patties with creamy dill sauce, plated with roasted potatoes, fresh cucumbers, tomatoes, and peppers. A Scandinavian weeknight dinner that feels fancy but takes under 30 minutes.

Total time
28 min
Servings
2
Calories
468
Protein
28g
Swedish Beef Wallenbergare with Roasted Veg
elegantcomfortscandinavianbeeftendercreamyweeknightdinner

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix ground beef with panko, egg, salt, and pepper until just combined; form into two thick oval patties.

  2. Step 2

    Heat butter and oil in a skillet over medium-high; sear patties 4 minutes per side until golden brown.

  3. Step 3

    Pour beef broth into the skillet around the patties; simmer uncovered 3 minutes until liquid reduces slightly.

  4. Step 4

    Stir sour cream and fresh dill into the pan; reduce heat to low and warm through 1 minute without boiling.

  5. Step 5

    While sauce simmers, warm or char potatoes and arrange fresh cucumbers, peppers, and tomatoes on a platter.

  6. Step 6

    Plate patties with dill cream sauce and arrange roasted potatoes and fresh vegetables alongside.

Tools you’ll need

  • 12-inch skillet or sauté pan
  • mixing bowl
  • spatula
  • wooden spoon
  • platter or dinner plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.