CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Swedish Beef Wallenbergare with Mashed Potatoes

Pan-seared beef patties bound with breadcrumbs and cream, served with creamy mashed potatoes, tangy gravy, and fresh vegetables. A Scandinavian weeknight dinner that tastes restaurant-quality but comes together in under 30 minutes.

Total time
28 min
Servings
2
Calories
620
Protein
34g
Swedish Beef Wallenbergare with Mashed Potatoes
comfortelegantscandinavianbeeftendercreamycrispyweeknight

Ingredients

  • ½ lb ground beef
  • ⅓ cup panko breadcrumbs
  • ½ cup heavy cream, divided
  • 1 cup beef broth
  • 1 lb russet potatoes, peeled
  • 3 tbsp unsalted butter
  • 1 selection fresh vegetables (mashed potatoes sides: cucumber, tomato, bell pepper, green beans)
  • 1 tbsp dijon mustard

Instructions

  1. 1

    Cut potatoes into 1-inch chunks. Boil in salted water until fork-tender, ~12 minutes. Drain well.

  2. 2

    While potatoes cook, mix ground beef, panko, 3 tbsp cream, and salt and pepper. Form into two thick patties.

  3. 3

    Heat 1 tbsp butter in a 10-inch skillet over medium-high until it foams. Sear patties 3 minutes per side without moving. Transfer to plate.

  4. 4

    Mash hot potatoes with 2 tbsp butter and 3 tbsp cream until smooth. Season with salt and pepper.

  5. 5

    Pour broth into the pan over medium heat. Stir in mustard and scrape up browned bits. Simmer 2 minutes until glossy.

  6. 6

    Arrange patties, mashed potatoes, fresh vegetables (sliced cucumber, tomato, bell pepper, steamed green beans) on plates. Pour gravy over patties and serve.

Tools you’ll need

  • 12-inch skillet
  • pot for boiling potatoes
  • wooden spoon
  • potato masher
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.