Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Swedish Beef Wallenbergare with Mashed Potatoes

Pan-seared beef patties bound with breadcrumbs and cream, served with creamy mashed potatoes, tangy gravy, and fresh vegetables. A Scandinavian weeknight dinner that tastes restaurant-quality but comes together in under 30 minutes.

Total time
28 min
Servings
2
Calories
620
Protein
34g
Swedish Beef Wallenbergare with Mashed Potatoes
comfortelegantscandinavianbeeftendercreamycrispyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut potatoes into 1-inch chunks. Boil in salted water until fork-tender, ~12 minutes. Drain well.

  2. Step 2

    While potatoes cook, mix ground beef, panko, 3 tbsp cream, and salt and pepper. Form into two thick patties.

  3. Step 3

    Heat 1 tbsp butter in a 10-inch skillet over medium-high until it foams. Sear patties 3 minutes per side without moving. Transfer to plate.

  4. Step 4

    Mash hot potatoes with 2 tbsp butter and 3 tbsp cream until smooth. Season with salt and pepper.

  5. Step 5

    Pour broth into the pan over medium heat. Stir in mustard and scrape up browned bits. Simmer 2 minutes until glossy.

  6. Step 6

    Arrange patties, mashed potatoes, fresh vegetables (sliced cucumber, tomato, bell pepper, steamed green beans) on plates. Pour gravy over patties and serve.

Tools you’ll need

  • 12-inch skillet
  • pot for boiling potatoes
  • wooden spoon
  • potato masher
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.