Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sweet Chili Baked Meatballs

Frozen meatballs tossed in sweet chili sauce and baked until sticky and caramelized, finished with a squeeze of fresh lime. Ready in 20 minutes—zero prep, maximum flavor.

Total time
20 min
Servings
4
Calories
285
Protein
16g
Sweet Chili Baked Meatballs
easysatisfyingamericanbeefstickytenderweeknightmain-dish

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat the oven to 400°F and line a baking sheet with foil.

  2. Step 2

    Spread frozen meatballs on the baking sheet in a single layer.

  3. Step 3

    Drizzle sweet chili sauce over the meatballs and toss until evenly coated.

  4. Step 4

    Bake for 15 minutes, stirring halfway through, until edges caramelize.

  5. Step 5

    Squeeze lime juice over the top and serve hot.

Tools you’ll need

  • oven
  • baking sheet
  • aluminum foil
  • spoon or tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.