Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Tahini Beef Kebab with Grilled Rice

Seasoned ground beef skewers with a charred crust, served alongside crispy grilled rice and creamy tahini sauce. Ready in under 30 minutes — Israeli street food that tastes like a fancy dinner.

Total time
25 min
Servings
2
Calories
540
Protein
32g
Tahini Beef Kebab with Grilled Rice
satisfyingcasualisraelibeefcrispytendercreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix ground beef, minced red onion, cumin, lemon zest, salt, and pepper in a bowl until just combined.

  2. Step 2

    Divide meat into 4 portions and mold onto skewers or into patties. Heat oil in a skillet over medium-high until it shimmers.

  3. Step 3

    Sear kebabs 3–4 minutes per side without moving. Crust should look dark brown; meat stays juicy inside.

  4. Step 4

    Remove kebabs. In the same skillet, press rice patties flat and sear 2 minutes per side until golden and crispy.

  5. Step 5

    Whisk tahini with lemon juice, 3 tbsp water, minced garlic, and salt until pourable. Taste and adjust.

  6. Step 6

    Plate rice, top with kebabs, drizzle tahini sauce, and scatter fresh parsley over top. Serve hot.

Tools you’ll need

  • large mixing bowl
  • 12-inch skillet or grill pan
  • metal skewers or meat molds
  • whisk
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.