Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Tanuki Udon

Chewy udon noodles topped with crispy tempura bits, tangy sweet sauce, and scallions. A vegetarian Japanese classic ready in 25 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
12g
Tanuki Udon
comfortcasualjapanesevegetarianvegetarianchewycrispyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a large pot of water to a rolling boil over high heat — you'll see vigorous bubbles breaking the surface continuously, about 8 minutes.

  2. Step 2

    Add the udon noodles to the boiling water and stir with a chopstick or fork to separate them, then cook until tender, about 3 minutes for frozen or 2 minutes for fresh.

  3. Step 3

    Drain the noodles in a colander, pressing gently with a spoon to remove excess water, then divide them between two bowls.

  4. Step 4

    Pour the dashi or broth into a small saucepan and set it over medium-high heat until it steams and small bubbles form around the edge, about 3 minutes.

  5. Step 5

    Add the soy sauce and mirin to the hot broth, stir for 10 seconds until combined, then divide the hot broth between the two bowls of noodles.

  6. Step 6

    Sprinkle half of the tempura flakes (about 1/4 cup) on top of each bowl of noodles and broth.

  7. Step 7

    Scatter the chopped scallions (about 1.5 tablespoons on each bowl) over the tempura flakes, then serve immediately while the broth is hot.

Tools you’ll need

  • large pot
  • colander
  • chopstick or fork
  • small saucepan
  • spoon
  • two bowls
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.