Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Tapioca de Frango

A beloved Brazilian street food: crispy tapioca crepes filled with shredded chicken, onions, and fresh cilantro. Naturally gluten-free and ready in under 40 minutes.

Total time
35 min
Servings
4
Calories
320
Protein
28g
Tapioca de Frango
casualsimplebraziliangluten-freechickencrispytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Place the chicken breast in a pot, cover with water by 2 inches, and bring to a boil over high heat. Once boiling, reduce heat to medium-low and simmer for 12–15 minutes, until the thickest part reaches 165°F on an instant-read thermometer.

  2. Step 2

    Remove the chicken from the pot using tongs and place it on a cutting board. Let it cool for 2 minutes, then shred it into bite-sized pieces using two forks pulling in opposite directions.

  3. Step 3

    Cut the onion in half from root to tip, then place cut-side down and slice lengthwise into thin half-moons about 1/8-inch thick.

  4. Step 4

    Chop the cilantro leaves and tender stems until you have a small mound that fills about 1/4 cup when lightly packed.

  5. Step 5

    Squeeze the lime juice into a small bowl — you should have about 1 tablespoon of juice.

  6. Step 6

    Heat 1 tablespoon of olive oil in a large skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 60 seconds.

  7. Step 7

    Add the sliced onion to the hot oil and stir every 15 seconds for 3–4 minutes, until the onion turns light golden and smells sweet.

  8. Step 8

    Add the shredded chicken, the lime juice, 1 teaspoon of salt, and the black pepper. Stir continuously for 1 minute until the chicken is warm and evenly coated.

  9. Step 9

    Remove the skillet from heat and stir in the cilantro. Taste and adjust salt if needed — the filling should taste savory and bright.

  10. Step 10

    Pour the tapioca starch into a shallow bowl or wide dish.

  11. Step 11

    Wipe out the skillet with a paper towel and set it back on the stove over medium-high heat. Add the remaining 2 tablespoons of olive oil and wait until it shimmers, about 60 seconds.

  12. Step 12

    Scoop about 3 tablespoons of tapioca starch into the hot oil, forming a loose, flat mound. Using the back of a spoon, gently press and spread it into a thin, uneven circle about 4–5 inches across, leaving a rougher texture (not smooth).

  13. Step 13

    Let the tapioca cook without moving it for 1–2 minutes until the bottom is set and light golden, then gently flip it using a spatula and cook the other side for 30–45 seconds until it looks crispy with light golden spots.

  14. Step 14

    Slide the tapioca crepe onto a plate. While still hot and pliable, place about 2–3 tablespoons of the chicken filling in the center, then fold the crepe in half like a half-moon.

  15. Step 15

    Repeat steps 12–14 with the remaining tapioca starch and filling until you have made 8 tapioca crepes total, adding oil to the skillet as needed.

Tools you’ll need

  • pot with lid (4-quart or larger)
  • instant-read thermometer
  • cutting board
  • chef's knife
  • two forks
  • small bowl
  • 12-inch skillet or larger
  • wooden spoon
  • shallow dish or wide bowl
  • spoon for pressing and shaping
  • spatula
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.