Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Tarte Tropézienne

A showstopping French pastry with crispy choux bun filled with rich cream and topped with toasted coconut. Impressive enough for guests but doable in one afternoon.

Total time
55 min
Servings
8
Calories
385
Protein
6g
Tarte Tropézienne
elegantindulgentfrenchvegetariancrispycreamyfluffyweekend

Ingredients

10 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat butter and water in a medium saucepan over medium heat until butter melts and mixture boils.

  2. Step 2

    Remove from heat. Add flour and salt, stirring vigorously until mixture forms a ball.

  3. Step 3

    Let dough cool 2 minutes. Add eggs one at a time, beating well after each until fully incorporated.

  4. Step 4

    Preheat oven to 400°F. Pipe dough into an 8-inch ring on a parchment-lined baking sheet.

  5. Step 5

    Bake 35–40 minutes until golden brown and puffed. Cool completely on a wire rack.

  6. Step 6

    Toast coconut in a dry skillet over medium heat, stirring often, until golden, ~4 minutes.

  7. Step 7

    Whip cold cream, granulated sugar, and vanilla until stiff peaks form, ~2 minutes.

  8. Step 8

    Slice cooled choux ring horizontally. Spread cream on bottom half, cover with top.

  9. Step 9

    Dust with confectioners sugar. Press toasted coconut onto sides and top, pressing gently.

  10. Step 10

    Chill 15 minutes before serving. Slice into 8 wedges with a hot, damp knife.

Tools you’ll need

  • medium saucepan
  • wooden spoon
  • piping bag with large round tip
  • baking sheet
  • parchment paper
  • wire rack
  • 12-inch skillet
  • wooden spoon for toasting
  • electric mixer or whisk
  • serrated knife
  • pastry brush or fork (optional, for pressing coconut)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.