Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Thai Crispy Shrimp & Chicken Salad

Crunchy mixed seafood and chicken with a tangy chili-lime dressing and fresh herbs. A restaurant-style Thai salad you can make in under 20 minutes.

Total time
18 min
Servings
2
Calories
248
Protein
38g
Thai Crispy Shrimp & Chicken Salad
freshlightthaigluten-freeshrimpchickencrispytender

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat shrimp and chicken dry with paper towels. Season both with salt and black pepper.

  2. Step 2

    Heat 1 tbsp oil in a large skillet over high heat until it shimmers, about 90 seconds.

  3. Step 3

    Add shrimp and cook without stirring until pink and opaque, about 2 minutes per side. Transfer to a plate.

  4. Step 4

    In the same skillet, add chicken and cook, stirring occasionally, until no pink remains and edges brown, ~5 minutes.

  5. Step 5

    Whisk lime juice, chili paste, and fish sauce in a small bowl until smooth.

  6. Step 6

    Toss greens with dressing in a large bowl. Top with shrimp, chicken, and fresh herbs. Serve immediately.

Tools you’ll need

  • 12-inch skillet
  • small bowl for dressing
  • large salad bowl
  • whisk
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.