Custrd is out on the App Store — Download it free →
Back to recipes

Thai Fish Cakes with Basil

Crispy golden fish cakes packed with fresh basil, served with a tangy dipping sauce and tender asparagus. A quick, flavorful weeknight dinner that brings Thai street food to your kitchen.

Total time
30 min
Servings
4
Calories
320
Protein
28g
Thai Fish Cakes with Basil
comfortingexoticthaigluten-freefishcrispytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a food processor, pulse the 1 lb fish fillets, 1 cup basil leaves, 2 tbsp fish sauce, and 1 egg until coarsely ground, about 10 pulses.

  2. Step 2

    Transfer the mixture to a bowl and stir in 0.5 cup panko breadcrumbs until just combined.

  3. Step 3

    Shape the mixture into 8 patties, about 2 inches wide and 1 inch thick.

  4. Step 4

    Heat 2 tbsp vegetable oil in a large skillet over medium-high heat. Cook the patties in batches, without crowding, until golden brown and cooked through, about 3 minutes per side.

  5. Step 5

    Remove the patties and set aside. Add the remaining 1 tbsp oil and the 1 bunch asparagus to the skillet. Cook, turning occasionally, until bright green and tender, about 5 minutes.

  6. Step 6

    Serve the fish cakes with the asparagus and 0.5 cup sweet chili sauce for dipping. Garnish with extra basil if you like.

Tools you’ll need

  • food processor
  • large skillet
  • mixing bowl
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.