Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Thai Stir-Fried Mixed Veg

A vibrant, 15-minute stir-fry of mixed vegetables tossed in a salty-sweet-spicy Thai sauce. One skillet, zero fuss — the kind of weeknight dinner that tastes way better than how easy it is.

Total time
15 min
Servings
2
Calories
165
Protein
5g
Thai Stir-Fried Mixed Veg
freshquickthaivegetarianvegancrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large skillet over medium-high heat for 90 seconds until it shimmers.

  2. Step 2

    Add mixed vegetables and stir-fry without stopping for 5–6 minutes until edges are lightly charred and tender-crisp.

  3. Step 3

    Whisk soy sauce, fish sauce, lime juice, sugar, and curry paste in a small bowl until paste dissolves.

  4. Step 4

    Pour sauce over vegetables and toss to coat evenly, stirring 1–2 minutes until glossy and fragrant.

  5. Step 5

    Serve immediately over rice or on its own, straight from the skillet.

Tools you’ll need

  • 12-inch skillet or wok
  • small bowl
  • whisk or fork

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.