Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Tom Kha Gai with Shrimp

Creamy coconut broth with tender shrimp, lime, and just enough heat. This one-pot Thai soup is restaurant-quality but ready in 20 minutes.

Total time
20 min
Servings
2
Calories
285
Protein
26g
20-Min Tom Kha Gai with Shrimp
cozycomfortingthaishrimpsilkytenderweeknightsoup

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring coconut milk and broth to a simmer in a large pot over medium-high heat.

  2. Step 2

    Stir in curry paste and ginger until the paste dissolves, about 1 minute.

  3. Step 3

    Add shrimp and cook without stirring for 2 minutes until they just start to turn pink.

  4. Step 4

    Stir gently and cook 2 more minutes until shrimp are opaque throughout.

  5. Step 5

    Remove from heat and squeeze lime juice over the top.

  6. Step 6

    Ladle into bowls and top with fresh cilantro. Serve immediately.

Tools you’ll need

  • large pot (3-quart minimum)
  • wooden spoon
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.