Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Kuay Teow Tom Yum

Silky rice noodles in a fragrant, spicy tom yum broth with shrimp, chicken, and fresh herbs. Ready in 30 minutes with bold, authentic Thai flavors.

Total time
30 min
Servings
2
Calories
420
Protein
38g
Kuay Teow Tom Yum
comfortboldthaishrimpchickensilkytenderweeknight

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut chicken breast into bite-sized pieces, roughly 1 inch.

  2. Step 2

    Soak rice noodles in room-temperature water for 15 minutes until pliable.

  3. Step 3

    Bring chicken broth to a boil in a large pot over medium-high heat.

  4. Step 4

    Stir in tom yum paste until dissolved, about 1 minute.

  5. Step 5

    Add chicken pieces and simmer 5 minutes until cooked through.

  6. Step 6

    Add shrimp and drained noodles. Simmer 3 minutes until shrimp pink.

  7. Step 7

    Squeeze lime juice into the pot. Stir in fish sauce and taste.

  8. Step 8

    Divide noodles and broth between two bowls.

  9. Step 9

    Top with cilantro, Thai basil, and sliced chilies. Serve immediately.

Tools you’ll need

  • large pot (6-8 quart capacity)
  • wooden spoon for stirring
  • colander for draining noodles
  • bowls for serving

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.