Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Torta Salata

A savory Italian vegetable tart with tender leeks, ricotta, and herbs baked in a flaky pastry crust. Rich, rustic, and elegant enough for dinner.

Total time
50 min
Servings
4
Calories
485
Protein
18g
Torta Salata
elegantrusticitalianvegetariancheeseflakycreamytender

Ingredients

13 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour and salt in a bowl. Add cold butter and rub with fingertips until breadcrumb-like.

  2. Step 2

    Add ice water 1 tbsp at a time, tossing gently, until dough just holds together.

  3. Step 3

    Flatten dough into a disk, wrap in plastic, and chill for 30 minutes.

  4. Step 4

    Heat olive oil in a large skillet over medium. Add leeks and cook, stirring, until soft and golden, ~12 minutes.

  5. Step 5

    Let leeks cool for 5 minutes. Transfer to a large bowl.

  6. Step 6

    Whisk ricotta, milk, eggs, Pecorino, parsley, thyme, and pepper into the leeks until smooth.

  7. Step 7

    Preheat oven to 375°F. Roll dough on parchment to fit a 9-inch tart pan or pie dish.

  8. Step 8

    Transfer dough to the pan, trim edges, and prick the bottom with a fork.

  9. Step 9

    Pour filling into the crust and smooth the top.

  10. Step 10

    Bake until the surface is golden and a knife inserted in the center comes out clean, ~25 minutes.

  11. Step 11

    Let rest 5 minutes before slicing. Serve warm or at room temperature.

Tools you’ll need

  • mixing bowl
  • large skillet
  • 9-inch tart pan or pie dish
  • rolling pin
  • parchment paper
  • pastry fork or whisk
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.