Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Erbazzone: Emilia-Romagna Herb and Cheese Pie

A rustic Italian savory pie filled with tender greens, garlic, and Parmigiano-Reggiano wrapped in buttery pastry. Golden and crispy, it's a complete dinner straight from Emilia-Romagna.

Total time
50 min
Servings
4
Calories
520
Protein
18g
Erbazzone: Emilia-Romagna Herb and Cheese Pie
comfortrusticitalianvegetariancheesecrispytenderflaky

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pulse flour, cold butter, and salt in a food processor until mixture resembles coarse sand.

  2. Step 2

    Add ice water 1 tbsp at a time, pulsing until dough just comes together.

  3. Step 3

    Flatten dough into a disk, wrap in plastic, and chill 20 minutes.

  4. Step 4

    Slice greens into 1-inch ribbons, discarding tough stems. Roughly chop any very large pieces.

  5. Step 5

    Heat 2 tbsp olive oil in a large skillet over medium-high. Add garlic and cook 30 seconds.

  6. Step 6

    Add greens in batches, stirring and pressing down until completely wilted, ~4 minutes total.

  7. Step 7

    Transfer to a colander and squeeze out excess liquid. Cool slightly, then stir in Parmigiano.

  8. Step 8

    Preheat oven to 400°F. Divide dough in half. Roll one half to fit a 10-inch pie dish.

  9. Step 9

    Spread cooled greens filling evenly over dough. Top with second dough round, seal edges.

  10. Step 10

    Cut small slits in top crust. Brush with 1 tbsp melted butter.

  11. Step 11

    Bake until golden brown on top and edges, ~20 minutes. Cool 5 minutes before slicing.

Tools you’ll need

  • food processor
  • plastic wrap
  • large skillet
  • colander
  • 10-inch pie dish
  • rolling pin
  • small pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.