CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Triple Cheese Penne

Creamy, melty pasta with three cheeses stirred into hot penne—no sauce simmering, just cheese melting into pasta water for instant richness. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
22g
Triple Cheese Penne
comfortsimpleitalianvegetariancreamytenderweeknightpasta

Ingredients

  • 8 oz penne pasta
  • ¾ cup mozzarella cheese, shredded
  • ½ cup parmesan cheese, grated
  • ½ cup cheddar cheese, shredded

Instructions

  1. 1

    Boil penne in salted water until al dente, about 9 minutes.

  2. 2

    Reserve 1 cup pasta water, then drain the pasta.

  3. 3

    Return pasta to the warm pot off heat.

  4. 4

    Add all three cheeses and stir until melted and creamy, about 2 minutes.

  5. 5

    Add pasta water 1/4 cup at a time until the sauce coats the pasta.

  6. 6

    Season with salt and pepper, then serve immediately.

Tools you’ll need

  • large pot
  • colander
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.