Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Turkish Lahmacun with Lemon & Arugula

Crispy, paper-thin flatbreads topped with spiced ground beef, finished with fresh lemon juice and peppery arugula. A showstopping 20-minute dinner that tastes like a Turkish restaurant.

Total time
20 min
Servings
2
Calories
380
Protein
18g
Turkish Lahmacun with Lemon & Arugula
casualelegantmiddle-easternbeefcrispytenderweeknightdate-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour with salt, pepper, and 1/4 cup water. Knead until a soft dough forms, then divide into 2 balls.

  2. Step 2

    Brown ground beef with minced onion over medium-high heat, breaking it up as it cooks, ~5 minutes.

  3. Step 3

    Stir in tomato paste, lemon zest, salt, pepper, and a pinch of red pepper flakes. Cook 1 minute until fragrant.

  4. Step 4

    Stretch each dough ball into a thin 8-inch circle on a sheet pan. Spread beef mixture evenly across each.

  5. Step 5

    Bake at 450°F for 8-10 minutes until crust edges are golden and crispy.

  6. Step 6

    Drizzle lemon juice over hot lahmacun. Top with fresh arugula and dill. Serve immediately.

Tools you’ll need

  • sheet pan
  • 12-inch skillet
  • mixing bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.