Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Urojo Soup

Tanzania's beloved street-food soup: a vibrant tangle of fried potatoes, chickpeas, tomatoes, and hot sauce bound with eggs. Finish with crispy chips for contrast and pure comfort.

Total time
45 min
Servings
4
Calories
420
Protein
14g
Urojo Soup
comfortcasualtanzanianvegetarianchickpeaseggscreamycrunchy

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut potatoes into 1-inch cubes. Slice tomatoes into chunks. Set aside.

  2. Step 2

    Heat 2 tbsp oil in a large pot over medium-high until shimmering.

  3. Step 3

    Add potato cubes, stirring occasionally, until golden and crispy outside, ~10 minutes.

  4. Step 4

    Pour in broth and bring to a simmer. Add chickpeas and tomatoes.

  5. Step 5

    Simmer 8 minutes until potatoes are tender. Stir in hot sauce.

  6. Step 6

    Whisk eggs in a bowl. Slowly pour into simmering soup while stirring gently until ribbons form, ~2 minutes.

  7. Step 7

    Heat remaining 1 tbsp oil in a skillet. Fry potato chips until golden if not store-bought fried.

  8. Step 8

    Taste soup and adjust salt, pepper, and hot sauce. Ladle into bowls.

  9. Step 9

    Top each bowl with crispy chips and serve immediately.

Tools you’ll need

  • large pot
  • cutting board
  • chef's knife
  • wooden spoon
  • whisk
  • medium skillet
  • ladle
  • serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.