Custrd is out on the App Store — Download it free →
Back to recipes

Vietnamese Broken Rice with Pork Rind and Grilled Pork

A quick weeknight version of the classic Vietnamese plate: grilled pork, crunchy pork rind salad, broken rice, and pickled veggies. All the flavor, ready in about 20 minutes.

Total time
20 min
Servings
2
Calories
650
Protein
35g
Vietnamese Broken Rice with Pork Rind and Grilled Pork
comfort foodweeknightvietnamesedairy-freeporkcrispytendereveryday

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cook the 1 cup broken rice in 1.5 cups water with a pinch of salt until tender, about 15 minutes. Fluff with a fork and keep warm.

  2. Step 2

    Thinly slice the 1 lb pork shoulder into 1/4 inch pieces. Toss with 2 tbsp fish sauce and 1 tbsp sugar (if you have it) and let sit while you prep veggies.

  3. Step 3

    Heat a grill pan or skillet over high heat. Cook the pork in a single layer until charred and cooked through, about 3 minutes per side. Set aside.

  4. Step 4

    Julienne the 1 cucumber and 1 carrot. Toss with 1 tbsp fish sauce, 1 tbsp sugar, and 1 tbsp vinegar (if you have it) for a quick pickle.

  5. Step 5

    Serve the rice topped with pork, pickled veggies, and 1 cup pork rinds. Garnish with cilantro or fried shallots if you have them.

Tools you’ll need

  • grill pan or skillet
  • pot with lid
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.