Custrd is out on the App Store — Download it free →
Back to recipes

Vietnamese Clay Pot Braised Chicken with Lemongrass

A quick and flavorful weeknight chicken braise with fragrant lemongrass and a savory-sweet sauce, cooked in a clay pot for that classic caramelized finish.

Total time
25 min
Servings
4
Calories
420
Protein
32g
Vietnamese Clay Pot Braised Chicken with Lemongrass
comfortingVietnamesegluten-freedairy-freechickentenderweeknightmain

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Trim the 2 lemongrass stalks, bruise them with the back of a knife, and cut into 3-inch pieces. Mince the 3 garlic cloves.

  2. Step 2

    In a bowl, mix the 3 tbsp fish sauce and 2 tbsp brown sugar until dissolved. Set aside.

  3. Step 3

    Heat the 1 tbsp vegetable oil in a clay pot or heavy skillet over medium-high. Add the 1.5 lb chicken thighs, skin-side down, and sear until golden, about 5 minutes per side.

  4. Step 4

    Add the lemongrass and garlic, then pour in the fish sauce mixture. Bring to a simmer, reduce heat to low, cover, and braise until the chicken is tender and the sauce is thick and glossy, about 15 minutes.

  5. Step 5

    Serve hot with steamed rice, spooning the sauce over the chicken.

Tools you’ll need

  • Clay pot or heavy skillet
  • Knife
  • Cutting board
  • Mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.